Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR108943.1 | 5prime_partial | 174 | 2-526(+) |
Amino Acid sequence : | |||
DDVVVQKDLTPLFSLDLHGNVNGAVETCLEAFHRYYKYLNFSNPLISSKFDPQACGWAFGMNIFDLIAWRKENVTGKYHYWQEQNANRSLWNLGTLPAGLLAFYGLTEPLDRRWHVLGLG YDLNIDNRLIETAAAIHFNGNMKPWLKLSIAKYRPLWEQYVNQAHKYLEDCLTS* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 20,171.697 | ||
Theoretical pI: | 6.312 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 53400 53525 | ||
Instability index: | 45.852 | ||
aromaticity | 0.144 | ||
GRAVY | -0.292 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.224 | ||
sheet | 0.270 |