Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR136343.1 | complete | 231 | 41-736(+) |
Amino Acid sequence : | |||
MKIQCDVCEKAPATVICCADEAALCAECDVEVHAANKLASKHQRLLLHCLSNKLPPCDICQEKPAFIFCVEDRALFCRDCDEPIHSANTRAANHQRFLATGIRVALGNSCSNETAKTDVD PKPPKSNSQHTLHVSGVASPLWGVDDLLQLSSPDKQKEQLEFSELEWLSDMSLFGEQVPEALSAAEVPQLPTSQPSHMISFRAAKSYAPYKKPRIEIPDDEEEFFIVPDLG* | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 11,708.137 | ||
Theoretical pI: | 7.638 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22250 | ||
Instability index: | 65.174 | ||
aromaticity | 0.073 | ||
GRAVY | -0.073 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.336 | ||
sheet | 0.273 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR136343.1 | complete | 110 | 552-220(-) |
Amino Acid sequence : | |||
MSESHSSSLNSSCSFCLSGDESCSKSSTPHRGDATPETWSVCCEFDLGGLGSTSVLAVSLLQLLPKATLIPVAKKRWWFAARVLAEWMGSSQSLQKSALSSTQKMNAGFS* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,708.137 | ||
Theoretical pI: | 7.638 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22250 | ||
Instability index: | 65.174 | ||
aromaticity | 0.073 | ||
GRAVY | -0.073 | ||
Secondary Structure Fraction | |||
Helix | 0.245 | ||
turn | 0.336 | ||
sheet | 0.273 |