Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR265168.1 | complete | 138 | 1-417(+) |
Amino Acid sequence : | |||
MAKAIRNACCNSNAHIGARVRPRKTPRKVIHVQASFNNTIVTVTDVRGRVVSWSSAGTCGFKGTRRGTPFAAQTAAANAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLTFVR DVTPMPHNGCRPPKKRRV* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 14,957.320 | ||
Theoretical pI: | 11.962 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
Instability index: | 36.629 | ||
aromaticity | 0.036 | ||
GRAVY | -0.290 | ||
Secondary Structure Fraction | |||
Helix | 0.225 | ||
turn | 0.239 | ||
sheet | 0.188 |