Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR265170.1 | complete | 138 | 1-417(+) |
Amino Acid sequence : | |||
MAKAIPRTGLRRNVCMNASTSAGTIPKGVIHVQASFNNTIVTVTDVRGRVVSWSSAGTCGFKGTRRGTPFAAQTAAANAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLTFVR DVTPMPHNGCRPPKKRRV* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 14,739.055 | ||
Theoretical pI: | 11.956 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 36.903 | ||
aromaticity | 0.036 | ||
GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
Helix | 0.232 | ||
turn | 0.254 | ||
sheet | 0.196 |