| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KR265170.1 | complete | 138 | 1-417(+) |
Amino Acid sequence : | |||
| MAKAIPRTGLRRNVCMNASTSAGTIPKGVIHVQASFNNTIVTVTDVRGRVVSWSSAGTCGFKGTRRGTPFAAQTAAANAIRTVVDQGMQRAEVMIKGPGLGRDAALRAIRRSGILLTFVR DVTPMPHNGCRPPKKRRV* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 14,739.055 | ||
| Theoretical pI: | 11.956 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 36.903 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.159 | ||
Secondary Structure Fraction | |||
| Helix | 0.232 | ||
| turn | 0.254 | ||
| sheet | 0.196 | ||