Acc_NO	ORF type	length	start-end position (strand +/-)
>KR734375.1	internal	205	3-617(+)
Amino Acid sequence :
FFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLLMNKWKFYLVNFWQCHFSMYFHTGRIHINQLSNH SRDFMGYLSSVRLNHSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRN
Physicochemical properties
Number of amino acids:		205
Molecular weight:		24,303.908
Theoretical pI:		9.391
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		36900 37150
Instability index:		37.487
aromaticity		0.176
GRAVY		0.029
Secondary Structure Fraction
Helix		0.415
turn		0.229
sheet		0.190