Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR734642.1 | internal | 122 | 1-366(+) |
Amino Acid sequence : | |||
RFFLHEYCSLITSKKPGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLLMNKWKFY LV | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 14,825.068 | ||
Theoretical pI: | 9.637 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
Instability index: | 38.625 | ||
aromaticity | 0.238 | ||
GRAVY | -0.043 | ||
Secondary Structure Fraction | |||
Helix | 0.451 | ||
turn | 0.180 | ||
sheet | 0.205 |