Acc_NO	ORF type	length	start-end position (strand +/-)
>KR734680.1	internal	112	1-336(+)
Amino Acid sequence :
YLVNFWQYYFNFWSYPYRIHINQLKNHSFLFGGYFSSVLINPLTVKNKMLDHSFLIDTVTKKFDTTIPVIPLIGSLSKAKFCTVSGHPNSKTIWADLSDSDIVGRFGRICRN
Physicochemical properties
Number of amino acids:		112
Molecular weight:		13,015.872
Theoretical pI:		9.517
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		25440 25565
Instability index:		18.139
aromaticity		0.170
GRAVY		-0.015
Secondary Structure Fraction
Helix		0.411
turn		0.268
sheet		0.116