Acc_NO	ORF type	length	start-end position (strand +/-)
>KR734694.1	internal	223	2-670(+)
Amino Acid sequence :
PGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLLMNKWKFYLVNFWQCHFSMYFHT GRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRNLFHYYSG
Physicochemical properties
Number of amino acids:		223
Molecular weight:		26,452.285
Theoretical pI:		9.557
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		41370 41620
Instability index:		37.074
aromaticity		0.184
GRAVY		-0.059
Secondary Structure Fraction
Helix		0.408
turn		0.238
sheet		0.179