Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR734731.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
ASSLHLLRFFLHEYCSLITSKKPGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLL MNKWKFYLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRNLF HYYS | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 28,971.257 | ||
Theoretical pI: | 9.581 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43110 | ||
Instability index: | 36.013 | ||
aromaticity | 0.180 | ||
GRAVY | -0.027 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.230 | ||
sheet | 0.193 |