Acc_NO	ORF type	length	start-end position (strand +/-)
>KR734735.1	internal	114	1-342(+)
Amino Acid sequence :
YLVNFWQYYFNFWSYPYRIHINQLKNHSFLFGGYFSSVLINPLTVKNKMLDHSFLIDTVTKKFDTTIPVIPLIGSLSKAKFCTVSGHPNSKTIWADLSDSDIVGRFGRICRNLS
Physicochemical properties
Number of amino acids:		114
Molecular weight:		13,216.107
Theoretical pI:		9.517
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		25440 25565
Instability index:		17.996
aromaticity		0.167
GRAVY		0.011
Secondary Structure Fraction
Helix		0.412
turn		0.272
sheet		0.123