Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR734735.1 | internal | 114 | 1-342(+) |
Amino Acid sequence : | |||
YLVNFWQYYFNFWSYPYRIHINQLKNHSFLFGGYFSSVLINPLTVKNKMLDHSFLIDTVTKKFDTTIPVIPLIGSLSKAKFCTVSGHPNSKTIWADLSDSDIVGRFGRICRNLS | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 13,216.107 | ||
Theoretical pI: | 9.517 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 17.996 | ||
aromaticity | 0.167 | ||
GRAVY | 0.011 | ||
Secondary Structure Fraction | |||
Helix | 0.412 | ||
turn | 0.272 | ||
sheet | 0.123 |