Acc_NO	ORF type	length	start-end position (strand +/-)
>KR734764.1	internal	168	2-505(+)
Amino Acid sequence :
LLRFFLHEYCSLITSKKPGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLLMNKWK FYLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRS
Physicochemical properties
Number of amino acids:		168
Molecular weight:		20,376.359
Theoretical pI:		9.759
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		34380 34505
Instability index:		39.224
aromaticity		0.214
GRAVY		-0.111
Secondary Structure Fraction
Helix		0.423
turn		0.208
sheet		0.196