Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR734922.1 | internal | 245 | 1-735(+) |
Amino Acid sequence : | |||
ASSLHLLRFFLHEYCSLITSKKPGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLL MNKWKFYLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRNLF HYYSG | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 29,028.308 | ||
Theoretical pI: | 9.581 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42860 43110 | ||
Instability index: | 35.907 | ||
aromaticity | 0.180 | ||
GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
Helix | 0.408 | ||
turn | 0.233 | ||
sheet | 0.192 |