Acc_NO	ORF type	length	start-end position (strand +/-)
>KR734952.1	internal	238	1-714(+)
Amino Acid sequence :
ASSLHLLRFFLHEYCSLITSKKPGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLL MNKWKFYLVNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRN
Physicochemical properties
Number of amino acids:		238
Molecular weight:		28,160.362
Theoretical pI:		9.618
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		39880 40130
Instability index:		34.304
aromaticity		0.172
GRAVY		-0.028
Secondary Structure Fraction
Helix		0.403
turn		0.231
sheet		0.193