| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KR735074.1 | internal | 117 | 1-351(+) |
Amino Acid sequence : | |||
| YLVNFWQYYFNFWSYPYRIHINQLKNHSFLFGGYFSSVLINPLTVKNKMLDHSFLIDTVTKKFDTTIPVIPLIGSLSKAKFCTVSGHPNSKTIWADLSDSDIVGRFGRICRNLSHYY | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,679.593 | ||
| Theoretical pI: | 9.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
| Instability index: | 22.602 | ||
| aromaticity | 0.179 | ||
| GRAVY | -0.038 | ||
Secondary Structure Fraction | |||
| Helix | 0.419 | ||
| turn | 0.265 | ||
| sheet | 0.120 | ||