Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR735074.1 | internal | 117 | 1-351(+) |
Amino Acid sequence : | |||
YLVNFWQYYFNFWSYPYRIHINQLKNHSFLFGGYFSSVLINPLTVKNKMLDHSFLIDTVTKKFDTTIPVIPLIGSLSKAKFCTVSGHPNSKTIWADLSDSDIVGRFGRICRNLSHYY | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,679.593 | ||
Theoretical pI: | 9.451 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
Instability index: | 22.602 | ||
aromaticity | 0.179 | ||
GRAVY | -0.038 | ||
Secondary Structure Fraction | |||
Helix | 0.419 | ||
turn | 0.265 | ||
sheet | 0.120 |