Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR735097.1 | internal | 230 | 2-691(+) |
Amino Acid sequence : | |||
FFLHEYCSLITSKKPGYSFSKKTQRFFFFLYNSYVYECESTFVFLRNQSSHLRSTSFGALLERIYFYGKIERLVEVFAKDFQVTLWLFKDPFIHYVRYEGKSILASKGTFLLMNKWKFYL VNFWQCHFSMYFHTGRIHINQLSNHSRDFMGYLSSVRLNHSMVRSQMLENSFLINNPIKKFDTLVPIIPLIGSLAKAHFCTVLGHPISKPVWSDLSDSDIIDRFGRICRN | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 27,282.332 | ||
Theoretical pI: | 9.550 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 39880 40130 | ||
Instability index: | 33.475 | ||
aromaticity | 0.178 | ||
GRAVY | -0.046 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.230 | ||
sheet | 0.183 |