Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR736921.1 | internal | 181 | 2-544(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRTVY | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,176.786 | ||
Theoretical pI: | 9.096 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 16.788 | ||
aromaticity | 0.122 | ||
GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.215 | ||
sheet | 0.227 |