Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR736972.1 | internal | 175 | 1-525(+) |
Amino Acid sequence : | |||
EYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRTVYECL | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 19,648.162 | ||
Theoretical pI: | 8.392 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 21.710 | ||
aromaticity | 0.120 | ||
GRAVY | -0.341 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.206 | ||
sheet | 0.240 |