Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR737353.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
SVGFKAGVKDYKLTYYTPEYKTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYSIEKVIGEDNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYSKTFEGPPHGIQAERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECL | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 20,341.927 | ||
Theoretical pI: | 8.240 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 26.716 | ||
aromaticity | 0.120 | ||
GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.234 | ||
sheet | 0.245 |