Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR935218.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
LVQTLRYWVKDTSSLHLLRFFLHEYWNWNSLIFPNNLISFFAKSNPRLFLFLYNSHVYEYESIFFFLRKQSFHLRSTFFRVLLERIYFFGKIEHFAEVFANDFQAILWLFKDPFMHYVRY QGKSILASKDTPLLLKKWKYYLVNLCQCHFSVWFQPAKICINPLSKQSLDFLGYLSSLRLNLSVVRSQMLENAFLIDNAMKKVDTRIPIIPLIRSLAKTKFCNAAGHPISQPIWAGSSDS DIINRFVRICRNLSHYYSG | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 30,860.673 | ||
Theoretical pI: | 9.705 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 57870 58120 | ||
Instability index: | 35.232 | ||
aromaticity | 0.178 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.432 | ||
turn | 0.216 | ||
sheet | 0.220 |