Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KR935219.1 | internal | 221 | 1-663(+) |
Amino Acid sequence : | |||
LVQTLRYWVKDTSSLHLLRFFLHEYWNWNSLIFPNNLISFFAKSNPRLFLFLYNSHVYEYESIFFFLRKQSFHLRSTFFRVLLERIYFFGKIEHFAEVFANDFQAILWLFKDPFMHYVRY QGKSILASKDTPLLLKKWKYYLVNLCQCHFSVWFQPAKICINPLSKQSLDFLGYLSSLRLNLSVVRSQMLENAFLIDNAMKKVDTRIPIIPLIRSLAKTKF | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 26,672.051 | ||
Theoretical pI: | 9.793 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 49390 49515 | ||
Instability index: | 33.790 | ||
aromaticity | 0.190 | ||
GRAVY | 0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.457 | ||
turn | 0.190 | ||
sheet | 0.240 |