Acc_NO	ORF type	length	start-end position (strand +/-)
>KS372615.1	internal	110	331-2(-)
Amino Acid sequence :
GTPRAIISDGGSHFCNKLFDGVLNKYNITHKVATPYHPQTSGLVEVSNRQIKGILERTVRPSRKDWAFKLNDALWAYRTAYKTPIGMSPYRLIFGKACHLPVELEHKAYW
Physicochemical properties
Number of amino acids:		110
Molecular weight:		12,558.324
Theoretical pI:		9.735
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		25440 25565
Instability index:		40.121
aromaticity		0.118
GRAVY		-0.421
Secondary Structure Fraction
Helix		0.318
turn		0.236
sheet		0.200