Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KS372615.1 | internal | 110 | 331-2(-) |
Amino Acid sequence : | |||
GTPRAIISDGGSHFCNKLFDGVLNKYNITHKVATPYHPQTSGLVEVSNRQIKGILERTVRPSRKDWAFKLNDALWAYRTAYKTPIGMSPYRLIFGKACHLPVELEHKAYW | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,558.324 | ||
Theoretical pI: | 9.735 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 40.121 | ||
aromaticity | 0.118 | ||
GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.236 | ||
sheet | 0.200 |