Acc_NO	ORF type	length	start-end position (strand +/-)
>KS372623.1	internal	136	3-410(+)
Amino Acid sequence :
QVTTVYCTFVGGNLVTWKSKKQTVIARSSAEAEYRAMASTACELIWLKGLLCDLGVPTTLPMSLFCDNQAAMHIASNPVFHERTKHIEIDCHYIREQVQSQVIQIHYTRSFDQLTDIFTK PLASHQFQRLLSKLGS
Physicochemical properties
Number of amino acids:		136
Molecular weight:		15,403.590
Theoretical pI:		8.347
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17210
Instability index:		59.179
aromaticity		0.088
GRAVY		-0.069
Secondary Structure Fraction
Helix		0.316
turn		0.169
sheet		0.235