Acc_NO	ORF type	length	start-end position (strand +/-)
>KS372743.1	internal	119	2-358(+)
Amino Acid sequence :
GEQHMNAVIRILRYLKSAPGKGVLFTKNSEFSRIEVYTDADWAGSINDRRSTSGYFTFVGGNLVTWRSKKQHVVARSSAEAEYRGMALGLCEALWLQSLLKDLTYPAKESIKLFCDNKA
Physicochemical properties
Number of amino acids:		119
Molecular weight:		13,380.127
Theoretical pI:		9.359
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23950 24075
Instability index:		47.511
aromaticity		0.109
GRAVY		-0.306
Secondary Structure Fraction
Helix		0.311
turn		0.227
sheet		0.269