Acc_NO	ORF type	length	start-end position (strand +/-)
>KS372815.1	internal	148	1-444(+)
Amino Acid sequence :
GPGRGGTCDISAWDAFYLAVFWMLNTIGWVTFYWHWKHITLWQGNVSQFNESSTYLMGWLRDYLWLNSSQLINGYNPFGMNSLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLAW AHERTPLANLIRWRDKPVALSIVQARLV
Physicochemical properties
Number of amino acids:		148
Molecular weight:		17,500.969
Theoretical pI:		8.122
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		91440 91440
Instability index:		35.833
aromaticity		0.203
GRAVY		0.145
Secondary Structure Fraction
Helix		0.432
turn		0.230
sheet		0.250