Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KS372826.1 | internal | 102 | 1-306(+) |
Amino Acid sequence : | |||
AATQDYPKSIVSNVHGVNPKFLEIGKKKMQQQQNGNQAFGKGAYYIGKMIWSKGYKELLKLLQNHQKELARLEVDLFGNGEDSDQIKEAAKKLKQPMRVHPG | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,525.136 | ||
Theoretical pI: | 9.664 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 16.411 | ||
aromaticity | 0.078 | ||
GRAVY | -0.825 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.235 | ||
sheet | 0.245 |