Acc_NO	ORF type	length	start-end position (strand +/-)
>KS372838.1	internal	112	1-336(+)
Amino Acid sequence :
PADKQRYQRLVGKLIYLSHTRPDIAYAVSVVSQFMHYPSEDHMDAVMRILRYLKSSPGKGLMFSKNGQLEVLGYTDSDWAGNMKDRKSTAGYFTFVGGNLVTWRSKKQNVVA
Physicochemical properties
Number of amino acids:		112
Molecular weight:		12,721.449
Theoretical pI:		9.778
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		21430 21430
Instability index:		33.523
aromaticity		0.116
GRAVY		-0.434
Secondary Structure Fraction
Helix		0.313
turn		0.241
sheet		0.205