Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KS372862.1 | internal | 99 | 2-298(+) |
Amino Acid sequence : | |||
GRRHNPHRSTPRVDRRTGSSPFHIRPRRIASPHPLPSRQFQALFDSLFKVLFIFPSRYLFAIGLSPVFSLGQNLPPDLGCIPKQPDSPTAPRGATAXPT | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,133.657 | ||
Theoretical pI: | 11.831 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 53.162 | ||
aromaticity | 0.092 | ||
GRAVY | -0.527 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.316 | ||
sheet | 0.153 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KS372862.1 | internal | 99 | 3-299(+) |
Amino Acid sequence : | |||
AAVTIRIGPRPESIGGPVHHRSTSDRDASPAPIRFPPDNFKHSLTLFSKSFSSFPRGTCLLSVSRPYLALDRIYRPIWAAFPNNPTRRQRLVVRQPXRR | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,133.657 | ||
Theoretical pI: | 11.831 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 53.162 | ||
aromaticity | 0.092 | ||
GRAVY | -0.527 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.316 | ||
sheet | 0.153 |