| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KT310071.1 | internal | 182 | 1-546(+) |
Amino Acid sequence : | |||
| ASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPSLDYGFKGSEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTVEALDILKLMSSTFLIALCQAIDLRHLEENLRLAV KNTVAQVAKKTLTTGANGELHPSRYCELELLRVVDREYVFAYVDDVCSGTYPLMQKLRQILV | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,189.851 | ||
| Theoretical pI: | 5.801 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10680 | ||
| Instability index: | 33.850 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.044 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.236 | ||
| sheet | 0.302 | ||