Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KT372781.1 | complete | 190 | 1-573(+) |
Amino Acid sequence : | |||
MDMAEQLCYIPCSYCNIILAVSVPCSSLFDVVTVRCGHCANLWTVNMAAAFPSLHASSFQDLHHHHHQGLSYAPSDYRVDLGSSSKWNYRMPMQPPSFINKPDQRIINRPPEKRQRVPSA YNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLESKNQDNKLEEDSEKHQMRRAAVLNK* | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,451.036 | ||
Theoretical pI: | 9.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
Instability index: | 50.324 | ||
aromaticity | 0.073 | ||
GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.230 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KT372781.1 | internal | 191 | 573-1(-) |
Amino Acid sequence : | |||
SFVQNGCPSHLMLLRILLKFIILVLALQHEPKMDMRKVCPIFGSSAESFPMADIRIVGLDSLNFLLNELIVCRWNTLPLLRGTIDDSLIWFVDEARRLHWHPVVPFGRGAEVDSVIRWSV AKTLMVMVMKILEGGGVQRGEGSSHIHSPKIGAVPTPNCHYIKQAAAWNTYRKNNIAVAARNVTQLLSHIH | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,451.036 | ||
Theoretical pI: | 9.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
Instability index: | 50.324 | ||
aromaticity | 0.073 | ||
GRAVY | 0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.230 | ||
sheet | 0.257 |