Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KT372783.1 | complete | 182 | 1-549(+) |
Amino Acid sequence : | |||
MSMELTAEPVCYVNCNYCNTILAVNVPYGSMFTIVTVRCGHCSNLLSVNMGALLQSVHLQDFQKQQCLGMEGGTIRDNGSSSKCNRYASLQLDTEQPKMPPIRPPEKRQRVPSAYNRFIK EEIQRIKASNPEISHREAFSTAAKNWAHFPHIHFGLNVDSNKQAKLDHPVAGEAAAQKSLGF* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 20,264.929 | ||
Theoretical pI: | 8.695 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
Instability index: | 51.346 | ||
aromaticity | 0.071 | ||
GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
Helix | 0.253 | ||
turn | 0.269 | ||
sheet | 0.242 |