Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KT372784.1 | complete | 161 | 1-486(+) |
Amino Acid sequence : | |||
MSVDMTLERVCYVQCNFCTTILAVNVPRSNMLNMVTVRCGHCANLLSVDMGGLLHSFYLQDFHQLEKQQSAADAAIQDTGSSSTCNRFTPLQSQHEQPKMPPIRTSEKRQRVPSAYNRFI KEEIQRIKASTPEITHRQAFSAAAKNWAHLPRIHFGLNKTS* | |||
Physicochemical properties | |||
Number of amino acids: | 161 | ||
Molecular weight: | 18,221.674 | ||
Theoretical pI: | 9.191 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
Instability index: | 54.867 | ||
aromaticity | 0.068 | ||
GRAVY | -0.400 | ||
Secondary Structure Fraction | |||
Helix | 0.248 | ||
turn | 0.224 | ||
sheet | 0.236 |