Acc_NO	ORF type	length	start-end position (strand +/-)
>KT372784.1	complete	161	1-486(+)
Amino Acid sequence :
MSVDMTLERVCYVQCNFCTTILAVNVPRSNMLNMVTVRCGHCANLLSVDMGGLLHSFYLQDFHQLEKQQSAADAAIQDTGSSSTCNRFTPLQSQHEQPKMPPIRTSEKRQRVPSAYNRFI KEEIQRIKASTPEITHRQAFSAAAKNWAHLPRIHFGLNKTS*
Physicochemical properties
Number of amino acids:		161
Molecular weight:		18,221.674
Theoretical pI:		9.191
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 10345
Instability index:		54.867
aromaticity		0.068
GRAVY		-0.400
Secondary Structure Fraction
Helix		0.248
turn		0.224
sheet		0.236