Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KT372786.1 | complete | 186 | 1-561(+) |
Amino Acid sequence : | |||
MDNYSQPSSSSSLAQSSHLSMLNMMMNSQPHDHQLYHHLDQNSGHVGFIPSVENNDDHKSSSAAVEVEGGGGGAEAENEAEGGKRKGDKKSKKPRFAFQTRSQVDILDDGYRWRKYGQKA VKNNRFPRSYYRCTHQGCNVKKQVQRLSKDEGIVVTTYEGVHSHPIQKSTDNFDHILSQMQIYTAF* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 12,853.430 | ||
Theoretical pI: | 9.236 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 23.977 | ||
aromaticity | 0.069 | ||
GRAVY | 0.801 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.198 | ||
sheet | 0.276 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KT372786.1 | complete | 116 | 405-55(-) |
Amino Acid sequence : | |||
MCASIVAPGKSIVLDSLLTIFPPPITIIKYIHLASCLEGKPRFLGLLIPLSLAAFRLVFRLRTTTTTLNLNGGGTRLMIIIIFDGWDEAHVSTILIKMMIQLMIVWLGVHHHVEHG* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 12,853.430 | ||
Theoretical pI: | 9.236 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 23.977 | ||
aromaticity | 0.069 | ||
GRAVY | 0.801 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.198 | ||
sheet | 0.276 |