Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KT384097.1 | 3prime_partial | 102 | 242-547(+) |
Amino Acid sequence : | |||
MLRACALDFRGNWSKHLHLAEFAYNNNYQASIKMAPYEALYGRPCRSPSCWVEFEDQVLTGPELIEEMNQQVKQIQKRLATAQSRQKSYADKRRIPLEFQAG | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,881.413 | ||
Theoretical pI: | 8.862 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 65.342 | ||
aromaticity | 0.108 | ||
GRAVY | -0.671 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.196 | ||
sheet | 0.304 |