Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU127422.1 | internal | 170 | 2-511(+) |
Amino Acid sequence : | |||
IELLIDPGTWDPMDEDMVSVDPIGFHSEDEPYRDRYDAYQRKTGLTEAVQTGTGQINGVPVGIGVMDFQFMGGSMGSVVGEKITRLIERAAERSLPLILVCASGGARMQEGSLSLMQMAK ISGALHDYQSNKKLFYVAVLTSPTTGGVTASFAMLGDINIAEPNAYIAFA | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 18,270.614 | ||
Theoretical pI: | 4.558 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 30.832 | ||
aromaticity | 0.076 | ||
GRAVY | 0.012 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.253 | ||
sheet | 0.276 |