Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU174204.1 | complete | 155 | 1-468(+) |
Amino Acid sequence : | |||
MADTFTQRYALVTGANKGIGFEICRQLASKGIVVILASRDEKRGLEARERLLKESRSISDGDVVFHQLDVVDPASVVVVADFIKTKFGRLDILVNNAGVSGVEIEGDISVFQEYAEANLN IIAAKGAQAHPFHPKTNGKLIETLKDAKECIETNY* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 11,617.512 | ||
Theoretical pI: | 8.250 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
Instability index: | 56.280 | ||
aromaticity | 0.091 | ||
GRAVY | 0.152 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.242 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU174204.1 | 5prime_partial | 99 | 468-169(-) |
Amino Acid sequence : | |||
LVICFYTLFCILQCLNQLSICFGMEWMCLRALSCNYVQICLSILLKHRNISLYLNSTNSRIIHQNIKPPEFRFDEVSNNDNASRVNDIELMKNNITIRN* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,617.512 | ||
Theoretical pI: | 8.250 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
Instability index: | 56.280 | ||
aromaticity | 0.091 | ||
GRAVY | 0.152 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.242 | ||
sheet | 0.222 |