| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KU230342.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
| PQTETKASAGFKAGVKDYRLTYYTPDHETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVG NVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDF | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 21,694.279 | ||
| Theoretical pI: | 7.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 26.753 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.223 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KU230342.1 | internal | 197 | 2-592(+) |
Amino Acid sequence : | |||
| PQTETKASAGFKAGVKDYRLTYYTPDHETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVG NVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDF | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 21,694.279 | ||
| Theoretical pI: | 7.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
| Instability index: | 26.753 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.223 | ||
| sheet | 0.254 | ||