Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU230351.1 | internal | 282 | 3-848(+) |
Amino Acid sequence : | |||
PVHAEILVQILQCWIQDVPLLHFLRFFLHEYHNWNSFLITQNKSIYLFSKETKRLFRFLYNSYVYECEFVFVFLRKHSSYLRFTSFQTFLERRYFYGKMEHLQTEHLIIVCCDYFNGTLW SFKDPFMHYARCQGKAILASKGTHLLMKKWKYNFVNLWQNYFYFWYQSYRIHINQLSNHSFHFLGYLSSLLKNSSTVRNQMLDNSFLIDTLTMKFDTAVPVIFLIRSLSKAQFCTVSGHP ISKPIWTDLSDSSIIERFGRICRNLSHYHSGSSKKQGLYRIK | |||
Physicochemical properties | |||
Number of amino acids: | 282 | ||
Molecular weight: | 34,011.995 | ||
Theoretical pI: | 9.556 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 65320 65695 | ||
Instability index: | 44.925 | ||
aromaticity | 0.184 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.202 | ||
sheet | 0.188 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU230351.1 | internal | 282 | 3-848(+) |
Amino Acid sequence : | |||
PVHAEILVQILQCWIQDVPLLHFLRFFLHEYHNWNSFLITQNKSIYLFSKETKRLFRFLYNSYVYECEFVFVFLRKHSSYLRFTSFQTFLERRYFYGKMEHLQTEHLIIVCCDYFNGTLW SFKDPFMHYARCQGKAILASKGTHLLMKKWKYNFVNLWQNYFYFWYQSYRIHINQLSNHSFHFLGYLSSLLKNSSTVRNQMLDNSFLIDTLTMKFDTAVPVIFLIRSLSKAQFCTVSGHP ISKPIWTDLSDSSIIERFGRICRNLSHYHSGSSKKQGLYRIK | |||
Physicochemical properties | |||
Number of amino acids: | 282 | ||
Molecular weight: | 34,011.995 | ||
Theoretical pI: | 9.556 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 65320 65695 | ||
Instability index: | 44.925 | ||
aromaticity | 0.184 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.411 | ||
turn | 0.202 | ||
sheet | 0.188 |