Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU497732.1 | complete | 213 | 1-642(+) |
Amino Acid sequence : | |||
MTSFSTFSEMLGSEYEPPVTLGEYCPKLAASCPKKPAGRKKFRETRHPVYRGVRLRNSGKWVCEVREPNKKSRIWLGTFLTAEIAARAHDVAAIALRGKSACLNFADSAWRLRIPETTCP KEIQKAAAEAALAFQAEINNTTTDHGLDMEETIVEAIFTEENNDVFYMDEESMLEMPALLASMAEGMLLPPPSVHFGHNYDFDGDADVSLWSY* | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 23,800.774 | ||
Theoretical pI: | 5.214 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
Instability index: | 48.021 | ||
aromaticity | 0.094 | ||
GRAVY | -0.329 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.216 | ||
sheet | 0.333 |