Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU499887.1 | internal | 214 | 1-642(+) |
Amino Acid sequence : | |||
EYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAET | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 24,194.158 | ||
Theoretical pI: | 5.828 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37360 37610 | ||
Instability index: | 32.940 | ||
aromaticity | 0.126 | ||
GRAVY | -0.410 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.210 | ||
sheet | 0.243 |