Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU499897.1 | internal | 275 | 1-825(+) |
Amino Acid sequence : | |||
FVLDILIPRSVHVEILIQTLRHWVKDVSSLHLLRVFLNEYWNWNSLLTPKKVSFSLSKRNQRLFFFLYNSHVCEYESIFVFLRNQSFHLRSTSSGVLLERIYFYIKIERLMNVFVKDFRA NLWLVEEPCMHYIRYQRKSILASKGTSLFMNKWKLNLVTFWQWHFSVWFHPRRIWINQFPKHSLEILGYLSNVQMNPSVVRSQILENSFLINNAIKKLDTLVPIIPLIAELAKAKFCNVL GHPISKPIRAELSDSNIIDRFSRICRNISHYHSGS | |||
Physicochemical properties | |||
Number of amino acids: | 275 | ||
Molecular weight: | 32,798.022 | ||
Theoretical pI: | 9.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 62910 63160 | ||
Instability index: | 45.631 | ||
aromaticity | 0.138 | ||
GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.429 | ||
turn | 0.229 | ||
sheet | 0.211 |