Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU556630.1 | internal | 207 | 1-621(+) |
Amino Acid sequence : | |||
EYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDL RIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAL | |||
Physicochemical properties | |||
Number of amino acids: | 207 | ||
Molecular weight: | 23,435.366 | ||
Theoretical pI: | 7.846 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 36120 | ||
Instability index: | 25.482 | ||
aromaticity | 0.126 | ||
GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.203 | ||
sheet | 0.246 |