| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KU559241.1 | internal | 154 | 1-462(+) |
Amino Acid sequence : | |||
| LTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIP PAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIK | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,077.134 | ||
| Theoretical pI: | 5.181 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 31.476 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.264 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.234 | ||
| sheet | 0.234 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KU559241.1 | internal | 154 | 1-462(+) |
Amino Acid sequence : | |||
| LTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIP PAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIK | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,077.134 | ||
| Theoretical pI: | 5.181 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26025 | ||
| Instability index: | 31.476 | ||
| aromaticity | 0.117 | ||
| GRAVY | -0.264 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.234 | ||
| sheet | 0.234 | ||