| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KU726608.1 | internal | 104 | 1-312(+) |
Amino Acid sequence : | |||
| GLGCVLMQHGKVIAYASRGLRVHEVNYPTHDLELAAVVHALKLWRHYLYGERVEVFTDHKSLKYIFTQKELNMRQRRWLEFLKDFDLDMQYHPGKANVVADALS | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,654.619 | ||
| Theoretical pI: | 7.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 77.053 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.176 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KU726608.1 | 5prime_partial | 102 | 312-4(-) |
Amino Acid sequence : | |||
| AKRIRHHIGFPRVILHIQIKVLQELQPPALPHIQLLLSEYILQTLVVGEDFDSLAVQVMPPQLQGMYNCRELQIMCRVVHLVNSQPSGRIGDDLTMLHKDTT* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,654.619 | ||
| Theoretical pI: | 7.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 77.053 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.176 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KU726608.1 | internal | 104 | 1-312(+) |
Amino Acid sequence : | |||
| GLGCVLMQHGKVIAYASRGLRVHEVNYPTHDLELAAVVHALKLWRHYLYGERVEVFTDHKSLKYIFTQKELNMRQRRWLEFLKDFDLDMQYHPGKANVVADALS | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,654.619 | ||
| Theoretical pI: | 7.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 77.053 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.176 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KU726608.1 | 5prime_partial | 102 | 312-4(-) |
Amino Acid sequence : | |||
| AKRIRHHIGFPRVILHIQIKVLQELQPPALPHIQLLLSEYILQTLVVGEDFDSLAVQVMPPQLQGMYNCRELQIMCRVVHLVNSQPSGRIGDDLTMLHKDTT* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,654.619 | ||
| Theoretical pI: | 7.218 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 77.053 | ||
| aromaticity | 0.039 | ||
| GRAVY | 0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.176 | ||
| sheet | 0.255 | ||