Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU743120.1 | internal | 169 | 3-509(+) |
Amino Acid sequence : | |||
YYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIERVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTA YVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYEC | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 18,870.258 | ||
Theoretical pI: | 8.389 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 21.489 | ||
aromaticity | 0.118 | ||
GRAVY | -0.327 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.213 | ||
sheet | 0.237 |