| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KU856585.1 | internal | 176 | 2-529(+) |
Amino Acid sequence : | |||
| TKASAGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFG FKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSA | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,335.689 | ||
| Theoretical pI: | 6.668 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 24.415 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.222 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KU856585.1 | internal | 176 | 2-529(+) |
Amino Acid sequence : | |||
| TKASAGFKAGVKDYRLTYYTPEYETKDTDILAAFRVTPQPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEAVVGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFG FKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSA | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,335.689 | ||
| Theoretical pI: | 6.668 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27390 27515 | ||
| Instability index: | 24.415 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.222 | ||
| sheet | 0.261 | ||