Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU977436.1 | complete | 314 | 1-945(+) |
Amino Acid sequence : | |||
MEENGMKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSTKTALLNEFQSMGAIIVKGEMDEHEKLVRLMKKVDVVISAVAIPQVLEQLKIVEAIKVAGNIKRFLPSDFGVEEDRIS ALPPFEACIEKKRIIRRAIEEANIPYTYVSANCFASYFINYLLHPSDPKDEITVYGTGEVKFAMNYEQDIGLYTIKVATDPRTLNRVVIYRPSTNITTQLELISKWEKKIGRNFKKIHIP EEEIVALTKELPEPENIPVAILHCVFIKGVTMSYDFKENDVEASTLYPELKFTTIDELLDIFLHDPPPPASAAF* | |||
Physicochemical properties | |||
Number of amino acids: | 314 | ||
Molecular weight: | 11,103.952 | ||
Theoretical pI: | 9.148 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 53.731 | ||
aromaticity | 0.067 | ||
GRAVY | 0.635 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.288 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KU977436.1 | complete | 104 | 416-102(-) |
Amino Acid sequence : | |||
MALLIILFFSMHASNGGNALILSSSTPKSDGRNLLIFPATLIASTILSCSRTCGIATADITTSTFFINRTSFSCSSISPLTMMAPMDWNSLRRAVLVELGLVKT* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,103.952 | ||
Theoretical pI: | 9.148 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 53.731 | ||
aromaticity | 0.067 | ||
GRAVY | 0.635 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.288 | ||
sheet | 0.279 |