Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX015721.1 | internal | 187 | 1-561(+) |
Amino Acid sequence : | |||
KASVGFKAGVKDYKLTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLR | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,677.332 | ||
Theoretical pI: | 8.585 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 28.112 | ||
aromaticity | 0.118 | ||
GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.235 | ||
sheet | 0.235 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX015721.1 | internal | 187 | 1-561(+) |
Amino Acid sequence : | |||
KASVGFKAGVKDYKLTYYTPDYVTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYNIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGF KALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLR | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 20,677.332 | ||
Theoretical pI: | 8.585 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
Instability index: | 28.112 | ||
aromaticity | 0.118 | ||
GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.235 | ||
sheet | 0.235 |