Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX096047.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYLN | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 26,080.316 | ||
Theoretical pI: | 6.809 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38850 39100 | ||
Instability index: | 30.958 | ||
aromaticity | 0.125 | ||
GRAVY | -0.397 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.220 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX096047.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
SVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYLN | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 26,080.316 | ||
Theoretical pI: | 6.809 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38850 39100 | ||
Instability index: | 30.958 | ||
aromaticity | 0.125 | ||
GRAVY | -0.397 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.220 | ||
sheet | 0.237 |