| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX096047.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
| SVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYLN | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,080.316 | ||
| Theoretical pI: | 6.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38850 39100 | ||
| Instability index: | 30.958 | ||
| aromaticity | 0.125 | ||
| GRAVY | -0.397 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.220 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX096047.1 | internal | 232 | 2-697(+) |
Amino Acid sequence : | |||
| SVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVVGEKDQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKA LRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYLN | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 26,080.316 | ||
| Theoretical pI: | 6.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38850 39100 | ||
| Instability index: | 30.958 | ||
| aromaticity | 0.125 | ||
| GRAVY | -0.397 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.220 | ||
| sheet | 0.237 | ||