| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX100882.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
| YKLTYYTPEYKTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGIEKVIGEDNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYSKTFEGPPHGIQAERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFT | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 20,065.575 | ||
| Theoretical pI: | 7.815 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
| Instability index: | 25.530 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.330 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.232 | ||
| sheet | 0.249 | ||