Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>KX100882.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
YKLTYYTPEYKTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGIEKVIGEDNQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLR IPPAYSKTFEGPPHGIQAERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFT | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,065.575 | ||
Theoretical pI: | 7.815 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30495 | ||
Instability index: | 25.530 | ||
aromaticity | 0.122 | ||
GRAVY | -0.330 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.232 | ||
sheet | 0.249 |