| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX108700.1 | 5prime_partial | 142 | 1-429(+) |
Amino Acid sequence : | |||
| FCDTWCELQNPVNHRVFERKLAPEAIRSRARLPGRHASRRSPQPCGCGDWPAVLRARRVEVPAVVGPGAANGGRIHRCLCLLSVSLPSTMRHVVVGPLTMDPSGFRIRRRNRPRNATPGQ AGLPAEFKHINKRRRRNLRGFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,952.388 | ||
| Theoretical pI: | 11.828 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11375 | ||
| Instability index: | 85.905 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
| Helix | 0.232 | ||
| turn | 0.289 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >KX108700.1 | 5prime_partial | 142 | 1-429(+) |
Amino Acid sequence : | |||
| FCDTWCELQNPVNHRVFERKLAPEAIRSRARLPGRHASRRSPQPCGCGDWPAVLRARRVEVPAVVGPGAANGGRIHRCLCLLSVSLPSTMRHVVVGPLTMDPSGFRIRRRNRPRNATPGQ AGLPAEFKHINKRRRRNLRGFP* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,952.388 | ||
| Theoretical pI: | 11.828 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11375 | ||
| Instability index: | 85.905 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.576 | ||
Secondary Structure Fraction | |||
| Helix | 0.232 | ||
| turn | 0.289 | ||
| sheet | 0.211 | ||